PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G1875
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 399aa    MW: 44404.3 Da    PI: 7.415
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G1875genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.8e-1775122148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++l ++++ +G+g+W+t ++  g+ R++k+c++rw +yl
      Gh_D02G1875  75 KGPWTAEEDLKLTNYIQVHGPGNWRTLPKNAGLQRCGKSCRLRWTNYL 122
                      79********************************************97 PP

2Myb_DNA-binding50.64.3e-16128172147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia  ++ gRt++++k++w+++
      Gh_D02G1875 128 RGRFSFEEEETIIQLHGILGNK-WSAIAGQLP-GRTDNEIKNYWNTH 172
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-2566125IPR009057Homeodomain-like
PROSITE profilePS5129417.10170122IPR017930Myb domain
SuperFamilySSF466891.65E-3072169IPR009057Homeodomain-like
SMARTSM007174.2E-1374124IPR001005SANT/Myb domain
PfamPF002495.5E-1575122IPR001005SANT/Myb domain
CDDcd001674.62E-1177122No hitNo description
PROSITE profilePS5129424.194123177IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-25126177IPR009057Homeodomain-like
SMARTSM007171.6E-14127175IPR001005SANT/Myb domain
PfamPF002494.5E-14128172IPR001005SANT/Myb domain
CDDcd001678.65E-11130173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MVPILFPTLY IYIYVEVYGS FRIDGLNINF SLFSIKPSPL SLTPSRKLQH TLKLNSSKGN  60
PMGRTPCCDK SGLKKGPWTA EEDLKLTNYI QVHGPGNWRT LPKNAGLQRC GKSCRLRWTN  120
YLRPDIRRGR FSFEEEETII QLHGILGNKW SAIAGQLPGR TDNEIKNYWN THIRKRLLRN  180
GIDPVTHAPR LDLLDLSSII SSTLCNQSLL NVSNLLGTQA LLNPQLLSLA NTLLSLKQEN  240
PEMLMQYLHQ NQLNLDPSLQ APIASVCTTT STVPCCTSML SQTGLIQATG EGFFSSDKTN  300
FSYPNSQENL TNLTNEFAAQ PHYVQCSTNP TVPILSETSN FQSVDGSFDS VRSSAISSPT  360
PLNSSSTFVN SSSTDDERES FSSLLKFEIP EGLDINDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-30731772105C-Myb DNA-Binding Domain
1msf_C3e-30731772105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5779241e-122JX577924.1 Gossypium hirsutum clone NBRI_GE9843 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479755.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP02e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0D2SKR30.0A0A0D2SKR3_G
STRINGPOPTR_0019s14070.11e-140(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.14e-85myb domain protein 41